PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G34670.1
Common NameAtMYB93, F21H2.9, MYB93
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 365aa    MW: 41196.9 Da    PI: 5.7535
Description myb domain protein 93
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G34670.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.95.4e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+d+++++G g+W++ ++   ++R++k+c++rw +yl
      AT1G34670.1 14 KGPWTPEEDQKLIDYIHKHGHGSWRALPKLADLNRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding53.17.2e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++++eE++ +++++  lG++ W++Ia +++ gRt++++k++w+++l
      AT1G34670.1  67 RGKFSAEEEQTILHLHSILGNK-WSAIATHLQ-GRTDNEIKNFWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-25564IPR009057Homeodomain-like
PROSITE profilePS5129418.605961IPR017930Myb domain
SuperFamilySSF466895.99E-3111108IPR009057Homeodomain-like
SMARTSM007171.9E-151363IPR001005SANT/Myb domain
PfamPF002499.2E-181461IPR001005SANT/Myb domain
CDDcd001671.10E-121661No hitNo description
PROSITE profilePS5129426.69762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.7E-2765117IPR009057Homeodomain-like
SMARTSM007177.8E-1666114IPR001005SANT/Myb domain
PfamPF002498.1E-1667112IPR001005SANT/Myb domain
CDDcd001671.06E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
PO:0020100anatomyhypocotyl
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MGRSPCCDEN GLKKGPWTPE EDQKLIDYIH KHGHGSWRAL PKLADLNRCG KSCRLRWTNY  60
LRPDIKRGKF SAEEEQTILH LHSILGNKWS AIATHLQGRT DNEIKNFWNT HLKKKLIQMG  120
IDPVTHQPRT DLFASLPQLI ALANLKDLIE QTSQFSSMQG EAAQLANLQY LQRMFNSSAS  180
LTNNNGNNFS PSSILDIDQH HAMNLLNSMV SWNKDQNPAF DPVLELEAND QNQDLFPLGF  240
IIDQPTQPLQ QQKYHLNNSP SELPSQGDPL LDHVPFSLQT PLNSEDHFID NLVKHPTDHE  300
HEHDDNPSSW VLPSLIDNNP KTVTSSLPHN NPADASSSSS YGGCEAASFY WPDICFDESL  360
MNVIS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28121165108B-MYB
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO183993890.0
Genevisible262406_at0.0
Expression AtlasAT1G34670-
AtGenExpressAT1G34670-
ATTED-IIAT1G34670-
Functional Description ? help Back to Top
Source Description
TAIRMember of the R2R3 factor gene family.
Function -- GeneRIF ? help Back to Top
  1. AtMYB93 is part of a novel auxin-induced negative feedback loop stimulated in a select few endodermal cells early during lateral root development.
    [PMID: 24902892]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00180DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G34670.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDabscisic acid, auxin, salicylic acid
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G34670
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5195600.0AY519560.1 Arabidopsis thaliana MYB transcription factor (At1g34670) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_174726.10.0myb domain protein 93
TrEMBLQ9S9Z20.0Q9S9Z2_ARATH; F21H2.9 protein
STRINGAT1G34670.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Jiao Y, et al.
    A genome-wide analysis of blue-light regulation of Arabidopsis transcription factor gene expression during seedling development.
    Plant Physiol., 2003. 133(4): p. 1480-93
    [PMID:14605227]
  4. Goda H, et al.
    Comprehensive comparison of auxin-regulated and brassinosteroid-regulated genes in Arabidopsis.
    Plant Physiol., 2004. 134(4): p. 1555-73
    [PMID:15047898]
  5. Czechowski T,Bari RP,Stitt M,Scheible WR,Udvardi MK
    Real-time RT-PCR profiling of over 1400 Arabidopsis transcription factors: unprecedented sensitivity reveals novel root- and shoot-specific genes.
    Plant J., 2004. 38(2): p. 366-79
    [PMID:15078338]
  6. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  7. Cao A,Jain A,Baldwin JC,Raghothama KG
    Phosphate differentially regulates 14-3-3 family members and GRF9 plays a role in Pi-starvation induced responses.
    Planta, 2007. 226(5): p. 1219-30
    [PMID:17598127]
  8. Feng S, et al.
    Coordinated regulation of Arabidopsis thaliana development by light and gibberellins.
    Nature, 2008. 451(7177): p. 475-9
    [PMID:18216856]
  9. Gibbs DJ, et al.
    AtMYB93 is a novel negative regulator of lateral root development in Arabidopsis.
    New Phytol., 2014. 203(4): p. 1194-207
    [PMID:24902892]